SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012875622.1.85100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012875622.1.85100
Domain Number 1 Region: 50-302
Classification Level Classification E-value
Superfamily PP2C-like 1.11e-61
Family PP2C-like 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012875622.1.85100
Sequence length 313
Comment protein-serine/threonine phosphatase [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence
MLSDIWKKIRNTEQTGDSGTEPERLSDEITQPLPVMEVNKANSGDVILGIRAAARTDSGR
VRRTNEDDVLLALPESNESVLPTIGIVAIADGMGGHDKGEVASRTAIEATINHLQNNPFF
TEGHFLRQNLSDDDVVNVVREAVQTANRAVYRTKVEQSTDMGTTLVLALILRGKSYIANV
GDSRAYIVRDRAIRRITEDHSLVERMIAAGQITEIEARRHPQRNLIFRSLGTEPVVEIDM
FVEPLRSGDRLLLCSDGLNSMVSDDVIADIVSHESDVDRACRLLIRAANDAGGADNISVA
LVEMVALEDQTSM
Download sequence
Identical sequences D1CCS3
WP_012875622.1.85100 525904.Tter_1682 gi|269926787|ref|YP_003323410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]