SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012876594.1.85100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012876594.1.85100
Domain Number 1 Region: 363-541
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.4e-41
Family Pyruvate oxidase and decarboxylase PP module 0.0018
Further Details:      
 
Domain Number 2 Region: 3-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.27e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.00086
Further Details:      
 
Domain Number 3 Region: 151-338
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.35e-34
Family Pyruvate oxidase and decarboxylase, middle domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012876594.1.85100
Sequence length 550
Comment thiamine pyrophosphate-binding protein [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence
MERKIYDAVAETLTYLGVKVFFGLIGSGNFHVSNALCEWGAQFIPARHEGGAITMADAWA
RLTGLVGVCTVHQGPGLTNTMTGLTEAVKSRTPLLLLAADTAGAAVHSNFKIDQEGLVRS
VGAIAERVHGPATVVEDTVRAWWRAQVERRPVVLMLPLDVQSAPFEGKVSIPPIAPIYPA
RPSGEAVTRTLYALEAAQRPLIIAGRGAVISGARDALEALGEQVGALMATSAAANGLFAG
NPWYVGISGGFASPAAAELIASADLVLAFGASLNMWTTRHGKLINPGATVVQVDHEPQAL
GYHHRVDIAVLGDARQTALELLRELLGHDISRQGWRTDEVARKLAEGCWQRAPYEDRSSE
LQIDPRTLSRALDEMLPEEKVLVTDSGHFMGYPAMYIRVPDAQGFVFTQAYQSVGLGLAT
AIGAAIARPDRLTVAALGDGGALMGLSELETVARLGLHMLIVIYNDSAYGAEVHHFGPEG
APLDIVRFPDFDFAPLAEAVGIRGVTVRKLEDLEAVGQWLEAEAEGAMLVDAKVVPDVVA
EWLEEAFRGH
Download sequence
Identical sequences D1CIJ2
gi|269839693|ref|YP_003324385.1| 525904.Tter_2675 WP_012876594.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]