SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012877222.1.53538 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012877222.1.53538
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-16
Family Thioltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012877222.1.53538
Sequence length 80
Comment thioredoxin family protein [Xylanimonas cellulosilytica]; AA=GCF_000024965.1; RF=representative genome; TAX=446471; STAX=186189; NAME=Xylanimonas cellulosilytica DSM 15894; strain=DSM 15894; AL=Complete Genome; RT=Major
Sequence
MVLFTRAGCHLCDDAREVVARVCGTLGETWHEVDVDTGPESATLRDRYGDYVPVVEVDGV
QQGFWQVDGDRLARRLTGRR
Download sequence
Identical sequences D1BVX5
446471.Xcel_0439 gi|269955247|ref|YP_003325036.1| WP_012877222.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]