SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012878890.1.53538 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012878890.1.53538
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-46
Family Glutathione peroxidase-like 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012878890.1.53538
Sequence length 152
Comment peroxiredoxin [Xylanimonas cellulosilytica]; AA=GCF_000024965.1; RF=representative genome; TAX=446471; STAX=186189; NAME=Xylanimonas cellulosilytica DSM 15894; strain=DSM 15894; AL=Complete Genome; RT=Major
Sequence
MALQPGEPAPDFTLQDTHGTPVHLADLLADGPVLLVFFPFAFSGICTGELCELRDNIEDF
ETAGVRLVAVSTDPVFTLKAWQQVEGYTFDLLSDFWPHGAVARAYGVLDEQNGHALRGTF
LIDAGGVVRWSVTNPRGQRRDLQAYRTALAEI
Download sequence
Identical sequences D1BUD5
446471.Xcel_2130 WP_012878890.1.53538 gi|269956917|ref|YP_003326706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]