SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012888541.1.100029 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012888541.1.100029
Domain Number 1 Region: 4-420
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.2e-66
Family Gtf glycosyltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012888541.1.100029
Sequence length 423
Comment glycosyl transferase [Streptosporangium roseum]; AA=GCF_000024865.1; RF=representative genome; TAX=479432; STAX=2001; NAME=Streptosporangium roseum DSM 43021; strain=DSM 43021; AL=Complete Genome; RT=Major
Sequence
MSLTILFMPESAYGPTNNCIGIGDILRKRGHRVVFAAEASWKGKLEALGFEEDLVDLAPP
SEEEQDPGQFWKDFIRDTAPEYRKSTSAQLETVTKPIWEALVDGAKYCEPQLKAIIERVQ
PDVIVEDNVITFPALLTAGKPFVRIVSCNPLEVRGEGVAPVFSGLPADDRSEWDAFRAEY
DRTHRELWTAFNEWVVAQGARPLPELDFIHEGDLNLYVFPEIADYTDARPLDGSWHRLDS
SVRETDGGFELPASLADRDGALVYFSLGSLGSADVSLMQRVIDVLGTTPHRFIVSKGPLH
EEIKLADNMWGAEFVPQTKIIPMADLVITHGGNNTTTEALHFGKPMILLPLFWDQYDNAQ
RIHELGYGVRLATYTFTDEELTGALDRLLGDAGLRERLAAAGEEIRRRDGLRKAADLIEQ
AGA
Download sequence
Identical sequences D2ATC0
479432.Sros_1806 WP_012888541.1.100029 gi|271963343|ref|YP_003337539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]