SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012913367.1.69553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012913367.1.69553
Domain Number 1 Region: 594-730
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.59e-39
Family Endonuclease I 0.00097
Further Details:      
 
Domain Number 2 Region: 116-316
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.27e-27
Family Prokaryotic proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012913367.1.69553
Sequence length 743
Comment endonuclease I [Pirellula staleyi]; AA=GCF_000025185.1; RF=representative genome; TAX=530564; STAX=125; NAME=Pirellula staleyi DSM 6068; strain=DSM 6068; AL=Complete Genome; RT=Major
Sequence
MDQTSIVAHSKLLKATADRFRRVFGESATRTESTVPLEAAPAIRHESFRARLESRTQFEL
LRGNPSDAIERRLRRLGFSTDIIRSATGSGPALEGKFDSRRIGLERIIGRNELLSVRYLD
AGRMAGRAVARVVIRSSSGSVLGYGTGSMISPSLFMTNSHVLDSAARAGNAVVEFNFQLG
LDGRELPVARFRLRPDLFFTTSPEEELDLTVVTVSEAAEGDSSTQLSTFGFNPLSASEGE
ILAGESVTVIQHPGGDLKQIALRENRVLRFPNTEDRFLYYETDTTPGSSGAPVFNDQWEV
VALHHSGFPERDNLGRLLTTDGLLWREEMGDERIHWIANEGIRVVAIREHLSGLGGLTST
QGTLRDVALNPQPIHPESEPVPGQRPVQVSVPSTVVPATSPVAAAGSTATWTIPLTVSVT
LGTPTGGAPSVATPVVTSSPPPATPSLAASRSSEEPEDADFEAARKIFEESRSRPYYDEN
TDAAERKAYYSGISSTLNPSQLFDALSKLVRNTHIKVLGYKPAIHLYPWVDLQPNHKIRS
IYSTQMFEPTEFIARDLEVARLRRERMNRFRRSEAAANPVLEAAFLESLEADLPYNCEHV
VPQSWFNKRQPMRGDLHHLFACESKCNSFRSNTPYFDFTNFGEAIRSDCGKSETNKFEPN
AGKGTVARATLYFLLRYPGEINSSTSEYTPDRLETLLQWHQDHPVSEYERHRNQAIFAAQ
GNRNPLVDHPDWAQHLDFEKGLG
Download sequence
Identical sequences D2R623
gi|283782213|ref|YP_003372968.1| WP_012913367.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]