SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012920962.1.69711 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012920962.1.69711
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily Prim-pol domain 1.5e-21
Family Bifunctional DNA primase/polymerase N-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  WP_012920962.1.69711
Domain Number - Region: 225-295
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00922
Family Bacterial dinuclear zinc exopeptidases 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012920962.1.69711
Sequence length 307
Comment DNA primase [Kribbella flavida]; AA=GCF_000024345.1; RF=representative genome; TAX=479435; STAX=182640; NAME=Kribbella flavida DSM 17836; strain=DSM 17836; AL=Complete Genome; RT=Major
Sequence
MTTPTPILTAALDAAGRGWPVFMLGRSKRPVANCETCRPVNGQPPHDPWSCGHLTCHGFY
AATTDTARVAAIVNAVPGGQLAVRTGMVSGLLVVDVDPAHGGWESLSELVARQLVPRTLW
VRTGSDGAHLYYRHPGLHMPSRPMPNRPGIDVKADGGYVVLPPSIHHRTRRPYAWGTGSD
LADPAAVVEMPPPLIAACLPATPAESTHAPSAPLSGPQRDTGGGGISHPDKLLTAHLDAV
RQAPQGKRRTTLYGAARGVARMVAAGALDPAAAVAALTYAGHQAAQTDRDIRAAIAGGFR
DEGITAA
Download sequence
Identical sequences D2PKT9
gi|284031274|ref|YP_003381205.1| WP_012920962.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]