SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012923120.1.69711 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012923120.1.69711
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Prim-pol domain 5.36e-24
Family Bifunctional DNA primase/polymerase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012923120.1.69711
Sequence length 292
Comment DNA primase [Kribbella flavida]; AA=GCF_000024345.1; RF=representative genome; TAX=479435; STAX=182640; NAME=Kribbella flavida DSM 17836; strain=DSM 17836; AL=Complete Genome; RT=Major
Sequence
MTHLLNAALDAAGRGWPVFMLGRSKRPVANCADCPKDAHAPDTCGHLTCHGFYAATTDPA
RLAAIINAVPGGQLAVRTGAVSGLAVIDVDPAHGGDASLSDLMTAGLVPRTRHVHTGSGG
LHLYYRHPGQHLPSRPMPNRPGIDVKADGGYVVLPPSIHHRTHRPYRWGTAGNDVVEMPP
ALVTACLPAPTPAESHTHPRTPVATTAGGGISHPDRLLSAHLDAVRNAPTGKRRTTLYGA
ARGVARMVAAGALDRTDAITALTDVGHQAAQTPRDIQAAITSGFRDEGIAAA
Download sequence
Identical sequences D2PN82
gi|284033434|ref|YP_003383365.1| WP_012923120.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]