SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012934022.1.44340 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012934022.1.44340
Domain Number 1 Region: 221-389
Classification Level Classification E-value
Superfamily SIS domain 3.24e-33
Family mono-SIS domain 0.00039
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily SIS domain 0.00000000321
Family mono-SIS domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012934022.1.44340
Sequence length 391
Comment phosphoheptose isomerase [Conexibacter woesei]; AA=GCF_000025265.1; RF=representative genome; TAX=469383; STAX=191495; NAME=Conexibacter woesei DSM 14684; strain=DSM 14684; AL=Complete Genome; RT=Major
Sequence
MSRAPAAPDALLAARLDAGEHFFAPAACDRIARCCHRMAERFARGGRLLAFGASAADRSD
VRHVAVEFVHPVIVGKRALPALGLAPHDLTLLAREHDVAIAFGAGASVAAGVRAARARGC
LTIGFADVGAEWRFAPPDDDPFVAQELVETLYHVLWELVHVFFEHRGLLAGRDAGSRHDS
GASSFLYPFLDEREHDLDAVLADVAASARAKSQEIGALRSQTLGDGRETLLNAAAALRRA
LDGGGTLLALGNGGSATDAMDAVADLREPSGTHGWPPRRALDLTADPAILTAIANDVGTE
AIFARQVIAYGRAGDGMLAFSTSGGSENVISALREARGRGVATVAFVGYDGGRILAEGLA
DFVVVTRSEHIPRIQEAQASAWHVLRELIEA
Download sequence
Identical sequences D3F8K7
gi|284044006|ref|YP_003394346.1| WP_012934022.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]