SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012934553.1.44340 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012934553.1.44340
Domain Number 1 Region: 182-364
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.31e-24
Family Thiamin pyrophosphokinase, catalytic domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012934553.1.44340
Sequence length 415
Comment thiamin pyrophosphokinase [Conexibacter woesei]; AA=GCF_000025265.1; RF=representative genome; TAX=469383; STAX=191495; NAME=Conexibacter woesei DSM 14684; strain=DSM 14684; AL=Complete Genome; RT=Major
Sequence
MAIAGALLATTAAGPSGRPRRMVVSVAVSHPTATQNGAAVHEVSGIARIGKRTKHLVKRL
RPGDIAIIDHRDLDRVSGEDLVACGIAGVVNCSPSSSGRYPNMGPLLVVQAGITLIDAPG
ADLMQTLHDGDPIVLRGGQVWRRDELMAEGELQEPERVQALTAKRRREIGEALEAFAANT
VQYMIEERDLLSGKLELPKFDTQFRDRPVLIVVRGVDHKRDIKALRAYIRDVKPVLVGVD
GGADAIIDEGFKPDMIVGDMDSATERTLRSGAELVVHAYSDGRAPGRNYLESLGLGYKIV
PAPGTSQDIAMLIAAEKGAELIVSVGSHFNLVEFLDKNRQGMASTFLTRLRVGEILVDAK
GVSRLYRPQPGLAPVLLLAATGVVALIVVILLTPALHDVADLLWLKLQVLLGIDA
Download sequence
Identical sequences D3FCZ0
gi|284044537|ref|YP_003394877.1| WP_012934553.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]