SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012954324.1.87152 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012954324.1.87152
Domain Number 1 Region: 4-170,267-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.22e-35
Family FAD-linked reductases, N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012954324.1.87152
Sequence length 406
Comment geranylgeranyl reductase [Candidatus Atelocyanobacterium thalassa]; AA=GCF_000025125.1; RF=na; TAX=1453429; STAX=713887; NAME=Candidatus Atelocyanobacterium thalassa isolate ALOHA; strain=ALOHA; AL=Complete Genome; RT=Major
Sequence
MVLRVAVVGSGPAGSSAAETLVKAGIETYLFERNLSYVKPCGGAIPLCMVDEFELPPTII
DRRVRKMKMISPSNIEVDLNLDNKDEYIGMCRREILDGFLRDRAVELGANLINGTVYQLD
TPQNSQDPYTIYYADHSNGQALGEKKTLQVDVIIGADGANSRIAKFIDAGDYNYAIAFQE
RIRLPKDKMNRYEDLAEMYVGKDVSPDFYAWIFPKYDHVAVGTGTMKNNQAMIKKLQAGI
RSRAFSRLEGGEVIKVEAHPIPEHPRPRRVVNRVALVGDAAGTVTKSSGEGIYFAAKSAR
MCAEIIVETSNSGRTIPTEDDLKLYLKRWDKQYGTTYLVLDILQHIFYRSDASREAFVEM
CADKNAQRMTFDSYLYKTVVPMNPLVQMKLTAKTIGSLLRGHALAP
Download sequence
Identical sequences D3EQ87
gi|284929496|ref|YP_003422018.1| WP_012954324.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]