SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012954581.1.87152 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012954581.1.87152
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.6e-67
Family Decarboxylase 0.00000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012954581.1.87152
Sequence length 232
Comment orotidine-5'-phosphate decarboxylase [Candidatus Atelocyanobacterium thalassa]; AA=GCF_000025125.1; RF=na; TAX=1453429; STAX=713887; NAME=Candidatus Atelocyanobacterium thalassa isolate ALOHA; strain=ALOHA; AL=Complete Genome; RT=Major
Sequence
MFSTNQIIVPLDVSDKKAVVNLLDKLPQVSFWKVGLEAFVALGPEIFSLLKDRQKKIFLD
LKFHDIPNTIAGACKSASNHGVDLITIHAAAGQKAMEAAAKAIASSSSTTKILAVTLLTS
LNSKELNCDLKISVELEQYALHMALLAQKLGIDGAVCSPHEVSQIRQLCGENFILVCPGV
RPSWSQVKDQKRIMQPKQALEAGADYLVIGRPITMADNPIEAWNRIINDITI
Download sequence
Identical sequences D3EQZ4
gi|284929753|ref|YP_003422275.1| WP_012954581.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]