SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012955315.1.7700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012955315.1.7700
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.61e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012955315.1.7700
Sequence length 99
Comment anti-sigma factor antagonist [Methanobrevibacter ruminantium]; AA=GCF_000024185.1; RF=representative genome; TAX=634498; STAX=83816; NAME=Methanobrevibacter ruminantium M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MELIKNYNEKELTIETGNKIDTTTAPDFENEIMDEMGNFDSLTLDLKNLEYISSAGLRVL
ILVQKKLKADDIPFVIINTNDNIKNILTMSGFDKILNIQ
Download sequence
Identical sequences D3E181
gi|288559770|ref|YP_003423256.1| WP_012955315.1.7700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]