SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012996815.1.81346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012996815.1.81346
Domain Number 1 Region: 239-314
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000000902
Family Cna protein B-type domain 0.0041
Further Details:      
 
Domain Number 2 Region: 147-218
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000271
Family Carboxypeptidase regulatory domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012996815.1.81346
Sequence length 320
Comment carboxypeptidase regulatory-like domain-containing protein [Natrialba magadii]; AA=GCF_000025625.1; RF=representative genome; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=ATCC 43099; AL=Complete Genome; RT=Major
Sequence
MSNSNRRHTTETRSIQTGVQVMLTVAGVVLLVAGLALAASGASINGALGPFGDDSDETEP
DVDEPDADGGDDDSTAGDDGGDTDETDETDDTDDADDGSESDESNDGAGDDDDGADDDDG
ADDEDDAGNGDENGGDDADDEHTLTATIEDDDGDEIENATVELTSGLSSSERTADDDGTV
EFTVDDGEYTLTASADGYEEAEADVEIDGDDEDVTLELESDEDEDEDEDDTDADDEYTLT
TLVEDDDDGDEIEDATIELYTGNQLFGPDAEATTDDDGEAELEVEEGEYTVIVTADDYEE
AEFNLEVDDDDEITVVLEED
Download sequence
Identical sequences D3SSJ7
gi|289582938|ref|YP_003481404.1| WP_012996815.1.6702 WP_012996815.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]