SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012996932.1.81346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012996932.1.81346
Domain Number 1 Region: 156-489
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-66
Family Subtilases 0.0000341
Further Details:      
 
Domain Number 2 Region: 1098-1178
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000000049
Family Carboxypeptidase regulatory domain 0.026
Further Details:      
 
Domain Number 3 Region: 1265-1346
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000255
Family Rhamnogalacturonase B, RhgB, middle domain 0.013
Further Details:      
 
Domain Number 4 Region: 1182-1257
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000000259
Family Cna protein B-type domain 0.007
Further Details:      
 
Domain Number 5 Region: 496-557
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000314
Family Type I dockerin domain 0.0034
Further Details:      
 
Weak hits

Sequence:  WP_012996932.1.81346
Domain Number - Region: 692-787
Classification Level Classification E-value
Superfamily YebC-like 0.0981
Family YebC-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012996932.1.81346
Sequence length 1710
Comment peptidase S8 [Natrialba magadii]; AA=GCF_000025625.1; RF=representative genome; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=ATCC 43099; AL=Complete Genome; RT=Major
Sequence
MTDSREQLTALLLTALMVLSLVAIAGTGLAGSVAATEHSDAQSAVDADADGPASIDAELE
EASGTEQIYIVLDQYDGQLSDDRDRAIAQLQEHAEVSQAAATEDIDALAGVDVINDYWIT
NAIRAEVDTSAVDTAELAMIDGAETIQLRPDYEVPEPEPSVEPAVEPDEDDYTYGLDQVN
ASETWADFNTQGEDVKVAVLDTGFDIDHQDLDLYTEDADDPTYPGGWVEIDADGDPVEGS
EPYDTHYHGTHVGGTVGAAAPADDDTPAYGVAPNVDLQHGLVLPDGSGADSDTIAGFEYV
VEEMDSDVVSMSFGAGCGLTGPVYEDAWIPVIQNANDMDVVAVTSSGNSGEGCVGSPANT
YDSFSIGASNEAGDITDFSSGNTIAADNWDNPDPEWPDEWVKPDVSAPGEDVLSAMPDDE
YDYLDGTSMSAPHVSGVIALMLSANDDLTQEEIEETLEETAWKPDGEPDEKDVRYGHGIV
DAYAAVDEVAAGALEYELGDVDQDGDVTVQDVQLTQQYLQDMDPEPFAEDLADMDRDGEV
TTDDLSLLQQKVQGMLDEGEIDITGLDVPDEVDDGEMFEVTVDLENLGEEGAVQEVDLFL
GDDDEPVDTEVVDMAAPGVDDPIDHPAETTITFELDAGDLDGGDHTITVETEDADASDTV
TVLASNFELSNLDAPDEADRGDEITVSADVENTGNVDDTQAVEYRFDDLGDALYAQNVTL
EADEETTVTFDVGTENITEGTYDHGVFTEDDEATATIDILEAFFSVDITDAPEELAPGET
YNVSADVVNSGDAPDEQTISYEVTEGETDVAVVDGDVDEEELREELADRGVDDVDLDELV
EGADNLADTLQDELDDSYDVETVNADDLLDEVDAYDVFVVNDFDGADVDTFLDELADDQG
VIYLENWGSSSNAVSDLSDATDDPSSVEDGFSGSAPIMLDITDDHALFDGVADAGETIEL
HDASDADRAWFDGYSGDVIADVGDGTPDGASVGVSEDDDHVLLAAFGRSSFITNADFSDE
SNAIMANAVEHVDDYAGTASATDHTSEVVSLEPNESATVEFTNTLAEDDGELEWHHVVES
DDDIATAPFTIDDGPNWNVKGTVSDDVTDEPIENASVELEAGNETYTNVTDADGEFGLAN
VPAGEHNLTVDAEGYAAHTESVEVPEDDIVTVDVGLEELPGTISGDVTASDDDAPVENAT
IVAENDDGDVHEATTDENGSYELDGVSAGTYVVNVVDTPPGYEIDEIVTVAPGEHVDDVD
FVVDRTAGSIEGTVTNAAGVPIADANVIDADDGAFNVTTAEDGSYEIEDVTPGTNALRAV
ADGYDDSNVEFVDVETGETTTANLTLGTYFEVDDLAAPDTAEQGEEITVNATVTNTGEQE
DTRTVFYFPPGTDFGTDVIDYQPELAETVTLEGGESTTVEFTYEVGADDEPGEYEHGVSA
DEVESTFITIEGDEDDGEPVFDVSDLDAPADAEPNETVSVTATLENTGDDAGTQTVTYAF
DDETVANETVSLDATESTELEFSTELPADEGTYEHTVSSENDSATAQTDVEEAGEPEPAY
FEVTEHDAPESVDAGEELTVNATITNTGDEADQQDIFLFWDAAMSDLEDAESVAELREAG
IDSMESIELEGGESDTVTLTHEVDSETEPGTYQYTVSTLQEMADGEVTVDDAAEVAFPAD
PGGFDGAPPGAALGANPFENGIANGIGLLG
Download sequence
Identical sequences D3T1J5
gi|289583606|ref|YP_003482016.1| WP_012996932.1.81346 gi|289583606|ref|YP_003482016.1|NC_013923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]