SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012998042.1.21818 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012998042.1.21818
Domain Number 1 Region: 337-544
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.8e-48
Family TAP-like 0.068
Further Details:      
 
Domain Number 2 Region: 39-174
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.45e-38
Family Ricin B-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012998042.1.21818
Sequence length 546
Comment hypothetical protein [Streptomyces scabiei]; AA=GCF_001550225.1; RF=na; TAX=1930; STAX=1930; NAME=Streptomyces scabiei; strain=95-18; AL=Contig; RT=Major
Sequence
MHTTRRLAARLTATASATCLAAVGLALVPAADASAAGAPQGGHVYALTAAHSGKNAAVLS
DSLANGARVVQKTVSGGPGQLWEAVDHGDGTFSLVNINSGKCMDIQNGSLNAGAAIIQWP
CTGAGNQRWTFSGSAVVSARSGLCLDVSDNSTAEDHAIIQWTCRNTTNQQWSLTERPRSA
TWGPAMVSGGQTFTSQTIRMVVHNNTSGAGLRIRLSNLRSTAALSVGAVTVAVQSSGATA
VAGTTRTVTFGRSATPTIPAGQEVTSDVIPMPVVAEQNLLVSVHLPGTTGASTYHNDAHQ
TSYLSAAGTGNHAAEEAATNFTTTTARWFYVAGLDVVSPTAKGTVVAIGDSITDGSSATN
NANQRWPDYLARRLQAQSGGQRLGVVNAGIGGNRVVTDSPSAQQGIAARTRFSHDVLTQP
GVKNAIVLEGINDINNTTTPTPADQIIAGYQTMIDQAHTAGVRIIGGTILPHSSQTAAKA
AIRAQVNDWIRTSGAFDAVIDFDAALRDPANPARLLPAYDSGDHLHPNSAGMQAIANAVD
LALLTS
Download sequence
Identical sequences C9ZBE8
WP_012998042.1.21818 WP_012998042.1.94791 gi|290954691|ref|YP_003485873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]