SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012998433.1.21818 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012998433.1.21818
Domain Number 1 Region: 60-342
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.03e-47
Family beta-glycanases 0.00000029
Further Details:      
 
Domain Number 2 Region: 338-432
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.97e-22
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012998433.1.21818
Sequence length 434
Comment glucuronoxylanase xynC [Streptomyces scabiei]; AA=GCF_001550225.1; RF=na; TAX=1930; STAX=1930; NAME=Streptomyces scabiei; strain=95-18; AL=Contig; RT=Major
Sequence
MTERQNEPERGRGGSPSRRTVLAAVGALPILTAVAPPAAGAVRAAAATAVIDPSARRQTI
RGFGGMTHTAWIGDLTAAQRDTAFGAGEGQLGLSLLRIPVPEDRAAWNRDLATAKRAAQL
GAAVIASPWNPPARMVETFVRGSQTDARRLRYDMYGAYAQHLNDFTTYMRDNGVNLYGIS
VQNEPDYAHDWTWWTPAEMLRFLRENAGSIGTRVIAPESFQYLKNMSDPILNDPVALANV
DIVGAHLYGTSFSNFPYPLFKQKGAGKELWMTEVYHPNSSDSADLWPQALDVGEHMHRAM
VDAEFQAYIWWYIRRGYGPLREDGRISKRGACMAHFARFVRPGYVRIDATPRPATDVYVS
AYRSTGSTVAVVAVNKSASAVSQQFTLTSGSPSRVSSWLTDASRSVAPQAATGVSNGSFT
ATLPARSVTTFVTG
Download sequence
Identical sequences C9YUC5
gi|290955086|ref|YP_003486268.1| WP_012998433.1.11737 WP_012998433.1.12502 WP_012998433.1.15999 WP_012998433.1.2165 WP_012998433.1.21818 WP_012998433.1.32552 WP_012998433.1.57887 WP_012998433.1.93747 WP_012998433.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]