SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013003218.1.94791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013003218.1.94791
Domain Number - Region: 77-152
Classification Level Classification E-value
Superfamily Prim-pol domain 0.0471
Family Bifunctional DNA primase/polymerase N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013003218.1.94791
Sequence length 281
Comment DNA primase [Streptomyces scabiei]; AA=GCF_000091305.1; RF=representative genome; TAX=680198; STAX=1930; NAME=Streptomyces scabiei 87.22; strain=87.22; AL=Complete Genome; RT=Major
Sequence
MTQPTPLRRALALAAHGVPALPLRAGKAPFGNCPTCAGNACGGRPNMKTPGPCTCPRPCH
GWAAATTDAYVLTSPPWAPAWRRAAAVAYHPGGAGVTVVDLDNAAAVDWARATLPTTRTV
PTTRGEHWTYRGVMRSVNGVREGVDIKSTMSYTRWLGPGVGATAALPDAVRALAVREPFP
SRRAPQALTVPPRGGQGECPHRTPTYLDRGVAMAEQRITEARSAVHATVYRTFLAVLSTH
GRCGCLTDTHVNRLFTAAQAKGESVRHCTDAWSNALTTLGL
Download sequence
Identical sequences C9Z138
gi|290960007|ref|YP_003491189.1| WP_013003218.1.11737 WP_013003218.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]