SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013003312.1.11737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013003312.1.11737
Domain Number 1 Region: 68-418
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.29e-37
Family beta-glycanases 0.016
Further Details:      
 
Domain Number 2 Region: 426-510
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000281
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013003312.1.11737
Sequence length 517
Comment endo-beta-1,6-galactanase [Streptomyces scabiei]; AA=GCF_001550215.1; RF=na; TAX=1930; STAX=1930; NAME=Streptomyces scabiei; strain=85-08; AL=Contig; RT=Major
Sequence
MTASPDPGHTQARPAPEPSATDRPTAAFGRRALLAAAGGAVVGTALGAGTAHADATITVN
PGTKYGTWEGWGTSLAWWANVFGARDDFADLWFTTKTTTYNGTALPGLGMNIARYNLGAC
SSNSINGESMVKSANIPAFKQIEGFWQDYTNENPASSAWKWTADPNQRAALTKAVARGAT
TELFANSPMWWMCSNHNPSGASGGGNNLQTWNYRQHASHLAAVALYAKNNWGVNFATVDP
FNEPASSWWTATGTQEGCHMDPAVQAAVLPYMRSELDARGLNSVRISASDETNYDTARST
WNSFNSATKALVSQVNVHGYQGADGRRDLLYTDVVTTAGKKLWNSETGDADGSGWTLARN
LCYDFRWLHPTAWVYWQVMDPTAGWAMIAYDANTLQPTTVQTKYYVMAQFSRHIRPGMTI
LDTGSPYTAAAYDAAARRLVIVAINTASSAQTLTFNLANFTTVTGGTNGLVPRWNTHTSG
GSDRYRAYSDTRLSGKTVAVPFAAGAVQTLQIDGVTI
Download sequence
Identical sequences C9Z2N2
gi|290960102|ref|YP_003491284.1| WP_013003312.1.11737 WP_013003312.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]