SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013005859.1.2165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013005859.1.2165
Domain Number 1 Region: 32-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.43e-53
Family alpha-L-arabinanase-like 0.00000999
Further Details:      
 
Domain Number 2 Region: 340-474
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.44e-38
Family Ricin B-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013005859.1.2165
Sequence length 476
Comment arabinase [Streptomyces scabiei]; AA=GCF_000738715.1; RF=na; TAX=1930; STAX=1930; NAME=Streptomyces scabiei; strain=NCPPB 4066; AL=Scaffold; RT=Major
Sequence
MTSQRAGGAFPEIRGRRVPPALAAILAALVVVMGLVTAGPAKALGGDVRMHDPSVIKVGH
CHYGFSTGFERDPLDPSGSLTIRKTCARTAATGWAKVGNVWETTPSWITAKLGATPPNIW
APDIAYFNGRYHLYYAGSRWGTNYAVMGLATAKHIEGPWTDQGMVTDVNYPIDPDVEKGP
HGRLYISWGSWTGSGTYMHALNPRTGKLSSTDNELRHVAINIENPTIIHNGGYYYLFGSK
GWCCNGVNSTYYTVVGRSTSITGPYLDRSGTGMLSDGGTTVLTGAYPKVAAGGADAFEDG
RSDFLAYHYYDGDNAGQETLDIRRVTFAGGWPVIAGPLGAAHNHLLNRNSGKCADVWYLS
TADDASVNSGNCNSGANQQWVSTPVGRNHQLVNVNSGKCLQVSGASTADGAAVVQSTCTG
APHQLWKRTPVIGGYVTFTNVRSGKCLEVAGASGDNGAALDQSTCAAGANHQWMVV
Download sequence
Identical sequences C9Z035
WP_013005859.1.11737 WP_013005859.1.15999 WP_013005859.1.2165 WP_013005859.1.82449 WP_013005859.1.94791 gi|290962762|ref|YP_003493944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]