SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013007246.1.2578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013007246.1.2578
Domain Number 1 Region: 12-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000573
Family Glutathione peroxidase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013007246.1.2578
Sequence length 169
Comment hypothetical protein [Deferribacter desulfuricans]; AA=GCF_000010985.1; RF=representative genome; TAX=639282; STAX=197162; NAME=Deferribacter desulfuricans SSM1; strain=SSM1; AL=Complete Genome; RT=Major
Sequence
MWKRNYFSGKNFLIYILVAYAFYYLYKYRQNDPPPLYTKVPNFELKTLNGKTFTLYDIKL
KKVIIFLNKNNIYSVFYKKNLSKIKHITDKKSAYLIIFVKTKQTPRSALNYISNKHYKPI
EKDLYLVNISEVEGIFGINSWPFLVILDEHNKIIYASKIPALKEIEKIL
Download sequence
Identical sequences D3PBM5
WP_013007246.1.2578 gi|291278919|ref|YP_003495754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]