SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013007475.1.2578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013007475.1.2578
Domain Number 1 Region: 193-305
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000372
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 30-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000656
Family Glutathione peroxidase-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013007475.1.2578
Sequence length 313
Comment hypothetical protein [Deferribacter desulfuricans]; AA=GCF_000010985.1; RF=representative genome; TAX=639282; STAX=197162; NAME=Deferribacter desulfuricans SSM1; strain=SSM1; AL=Complete Genome; RT=Major
Sequence
MRIANLIIIFFIFTNVCFSFPLKNIKKGDVFDFSKFTSQESNFANSLKDKKIKMVLLWRS
DKQLSVKIAKNFKKICSTKNIYCYSMDIKQIKKDELLKLIGDLSKNFYVTLYNGDIIEDL
GIYTLPVTIFLDKNNKVIDAIGYEGQYYVKINRYLDYLTGKISKDEYEKYSNTSVVDRRR
SILPEINFIKRLIRDSQKDDAIKRLSSLKLDNLTNFEKVKLSEVYILLQRYKDAVKLLEP
ISDKFIDAKFYLSLAYYNIGEYEKSLNLLKNIEKIYPNKRRLYFLLGKVYKSKGDFKKGC
EYFEKSCEQNLIN
Download sequence
Identical sequences D3PCA4
gi|291279148|ref|YP_003495983.1| WP_013007475.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]