SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013007883.1.2578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013007883.1.2578
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-40
Family Thioltransferase 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013007883.1.2578
Sequence length 105
Comment thiol reductase thioredoxin [Deferribacter desulfuricans]; AA=GCF_000010985.1; RF=representative genome; TAX=639282; STAX=197162; NAME=Deferribacter desulfuricans SSM1; strain=SSM1; AL=Complete Genome; RT=Major
Sequence
MALTFTEENFQKEVLESDIPVLVDFWAVWCGPCKMLAPTIDQLANELEGKVKVGKVNVDE
NQSLAARYGIMSIPTVMIFKDGKVVEQFIGVQPKGVYVDALNKYL
Download sequence
Identical sequences D3PDG3
gi|291279557|ref|YP_003496392.1| WP_013007883.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]