SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013008638.1.2578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013008638.1.2578
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.43e-34
Family Glutathione peroxidase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013008638.1.2578
Sequence length 166
Comment thioredoxin family protein [Deferribacter desulfuricans]; AA=GCF_000010985.1; RF=representative genome; TAX=639282; STAX=197162; NAME=Deferribacter desulfuricans SSM1; strain=SSM1; AL=Complete Genome; RT=Major
Sequence
MRIKSILAVSILVLSLLFSSCSQNQQAENTKQIVSSLETINVAQFKELKNRYKDKVILVN
FFASWCPPCNQETPGFVRVYNKLKDKGFIILAFSIDDNVDDAVKFVNKYGITYPVYHADR
SLEAYFNVSTIPTSVFYKKGGTLYNLHVGYIDEKDLENYILDLLNK
Download sequence
Identical sequences D3P9K3
WP_013008638.1.2578 gi|291280314|ref|YP_003497149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]