SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013021540.1.89426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013021540.1.89426
Domain Number 1 Region: 92-226
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.2e-25
Family GntR ligand-binding domain-like 0.000081
Further Details:      
 
Domain Number 2 Region: 18-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.68e-17
Family GntR-like transcriptional regulators 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013021540.1.89426
Sequence length 232
Comment GntR family transcriptional regulator [Stackebrandtia nassauensis]; AA=GCF_000024545.1; RF=representative genome; TAX=446470; STAX=283811; NAME=Stackebrandtia nassauensis DSM 44728; strain=DSM 44728; AL=Complete Genome; RT=Major
Sequence
MTTPPPESFVYESRTVDPPTRNSTAEFVAGLLRTEIADGKRQPGDKLPEAELCELHQVSR
NTLREAFQLLTHERLVIHNLNRGFKVRRPSAEDLSDIYRVRRVIECGAIRSAVIVPERLA
GLQRAVADGERAAKQHDGRAVGSANIQFHRSIGSLAESARIDEVMNQVLAELRLVFHVMG
NHGDFHLPYLPRNREILDCLAEHDIMRASQLLSNYLDDAEEQLQAAYEEADS
Download sequence
Identical sequences D3Q484
gi|291303784|ref|YP_003515062.1| WP_013021540.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]