SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013037127.1.50250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013037127.1.50250
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-43
Family BPHL domain 0.0000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013037127.1.50250
Sequence length 124
Comment hypothetical protein [Methanohalophilus mahii]; AA=GCF_000025865.1; RF=representative genome; TAX=547558; STAX=2176; NAME=Methanohalophilus mahii DSM 5219; strain=DSM 5219; AL=Complete Genome; RT=Major
Sequence
MGLSGIFGNAGVVEPDKLESDYGQFMCDGETIEIGFVVIRDTFIFTNKRLVIVDIQGMTG
KKRSYLSIPYGKITKYSIETSGHFDLDAELNIWVGNDPQPIEKSFNKKVDIYDLQKILST
HVLG
Download sequence
Identical sequences D5EAI3
gi|294495336|ref|YP_003541829.1| WP_013037127.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]