SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013050494.1.44054 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013050494.1.44054
Domain Number - Region: 136-184
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0049
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013050494.1.44054
Sequence length 221
Comment SecY-interacting protein [Shewanella violacea]; AA=GCF_000091325.1; RF=representative genome; TAX=637905; STAX=60217; NAME=Shewanella violacea DSS12; strain=DSS12; AL=Complete Genome; RT=Major
Sequence
MSSLPALDNLFKIYQLAYFEKLGELPRYYPRGEGSTCIEGEYEPSNYHESDEEVSVCWKP
VTRPEPGSFSNIETALELEFGPDIDAFFGEYFSAPLLFNCEWGQGELLQVWNQTDFEYLQ
QNIIGHLMMKKKLKQAPTWFIGVLGDGDNMLTVDISDGSVWIEIPGEAPSEKLADSLNEF
ISQLTPRVAPPELHIEESMPELDHPGIWNRIKLMWRNLRGK
Download sequence
Identical sequences D4ZHN4
WP_013050494.1.44054 gi|294139983|ref|YP_003555961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]