SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013064002.1.33358 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013064002.1.33358
Domain Number 1 Region: 670-775
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000711
Family Glutathione peroxidase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013064002.1.33358
Sequence length 796
Comment hypothetical protein [Prevotella ruminicola]; AA=GCF_000025925.1; RF=representative genome; TAX=264731; STAX=839; NAME=Prevotella ruminicola 23; strain=Bryant 23; AL=Complete Genome; RT=Major
Sequence
MKKLLSTIVLAIVATAGWAQTRIWNNIVTGYSNVPFVKITKVVLSADSTEVFMHFDMPER
AAGQEGVLAAKSLLQADGKTYEAKNAVGMKLGQPVKIPKDCKVDFSLVFDALPASTWLFS
ISDPGIWIINAVRDADANADVDVTPVGITDTYWRNTLTGDWLIGFAQHHVIYNNKVWDIL
NQTEQKDTYVLTLNDGLTIKVGKLKKGIRPITIGTGKAIACNPITQEALPDYPTKDTRKG
FVDNGYREGDSVTIVGWLKDMPEQAWKQSGEFEVWTSNFITDKTESFTAKLDSLGRFTLR
MPLLNSATVTLAPRQSWVHPVLEPGKTYFFLNDFNTGQKLFMGDDVRLQNELVACPATWP
ETRINPGESAMQFMERANKVFDAIITKMQADITHRPNLSQRFIDYIKGLCMAGQGYSMMQ
ARFDVPGRSLPKEYMDYVNTKLWQPAPKPYTLYSEFPRFMRDYLDQLRDERHSVSIDPYR
ITLNDGAYPIILRQARADGKVSITDEELALMERYAVEFHKEYAKQAKNQKIDSLNIDLAG
TDLDKLGIAEQYLAIMERPDVKKEIEQEFSLIDLYYQKQAIESATTDRALIDLALARKFY
WKLNSFRKSLDPSDLNFANKEIKLASALNFVLTENDKYVALEHQDLANAASLRPSTDVAN
MTDGEKMLRKIIEPYKGRVIYLDVWGTWCGPCKQKLKDSWKVKEALKDYDIVYLYLCNGS
SDESWKNVIKEYNLTGPNCVHYNLPKEQQSAIEHYLSVNSFPTYKIIDKQGNIHDLGWLD
DQNLEAFKQTMGKFCK
Download sequence
Identical sequences A0A1H6MVG5 D5ERP8
gi|294673686|ref|YP_003574302.1| WP_013064002.1.33358 WP_013064002.1.49956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]