SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013064023.1.49956 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013064023.1.49956
Domain Number 1 Region: 196-332
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.95e-16
Family Glutathione peroxidase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013064023.1.49956
Sequence length 333
Comment lipoprotein [Prevotella ruminicola]; AA=GCF_900108375.1; RF=na; TAX=839; STAX=839; NAME=Prevotella ruminicola; strain=ATCC 19189; AL=Scaffold; RT=Major
Sequence
MKQTCLLALVAAFLLCSCGDGQKKFKIEGSFKGFNQGELYVYGLNGAQKLDTIGVSRGEF
TYKADITEPTTLIVVFPNFSEIPVFAEPGVTITMEGDAVHLKETEVKGTNINKEMTAFRL
KTSAMMPPGVKGTATQYIYERPESPICTYLLTKYFVMVPNPDYDNIQKLGNMIMKAQPDN
KEVAALLKKLGALRAVKQGAHLPSFSAKGLKGEIVSSADLNAKVNVISLWASWNYESMSI
QGLLARLQRENPGKLKVVSISVDGSVKDCQQIVNRDSVRWSTVCDGRMWESPILQQLGMT
YLPDNIVIDGQGKIVGRTLDYQKLNDKIKELIE
Download sequence
Identical sequences A0A1H6LHH9 D5EVY8
WP_013064023.1.33358 WP_013064023.1.49956 gi|294675027|ref|YP_003575643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]