SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013096337.1.92861 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013096337.1.92861
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 3.4e-45
Family Lambda phage gpU-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013096337.1.92861
Sequence length 132
Comment MULTISPECIES: tail protein [Proteobacteria]; AA=GCF_000755525.1; RF=na; TAX=550; STAX=550; NAME=Enterobacter cloacae; strain=ATCC 13047; AL=Scaffold; RT=Major
Sequence
MKHPQIRAAVLTALKRSITEQITWFDGRPGFLEEEDLPAVAVYLTDARASEDSVDEDMWT
ALLHIEVFLKAKETDSALDAWMEEKVYPALADIPELLPLIELMNANGYDYQRDEEVMMWG
SADLSYSISYVM
Download sequence
Identical sequences A0A0H3CH90 A0A0M7I2K5
gi|296102067|ref|YP_003612213.1| WP_013096337.1.12136 WP_013096337.1.2945 WP_013096337.1.38242 WP_013096337.1.40358 WP_013096337.1.55189 WP_013096337.1.88665 WP_013096337.1.92861 WP_013096337.1.97677 YP_003612213.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]