SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013129800.1.1770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013129800.1.1770
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily Prefoldin 6.02e-16
Family Prefoldin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013129800.1.1770
Sequence length 159
Comment ATP-binding protein [Thermosphaera aggregans]; AA=GCF_000092185.1; RF=na; TAX=633148; STAX=54254; NAME=Thermosphaera aggregans DSM 11486; strain=DSM 11486; AL=Complete Genome; RT=Major
Sequence
MSDVQAEGGKTITLEELIARASELREYITVLSNTINSYVTQYRELQLASETLKNLPEAGG
EGFVVVDRLSSVLVPGIVKEGWTASVLVNIGFGYYLKTSRDKAVEVIEKRLASVNRLLDE
LQKRYKTALDEYSALQGILNQVYAEAQNTEEAGGQASGG
Download sequence
Identical sequences D5U257
gi|296242672|ref|YP_003650159.1| WP_013129800.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]