SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013130096.1.1770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013130096.1.1770
Domain Number 1 Region: 3-76,164-334
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 5.93e-75
Family Pyruvate kinase 0.000028
Further Details:      
 
Domain Number 2 Region: 319-450
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.00000000000000139
Family Pyruvate kinase, C-terminal domain 0.0068
Further Details:      
 
Domain Number 3 Region: 71-164
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000628
Family Pyruvate kinase beta-barrel domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013130096.1.1770
Sequence length 467
Comment pyruvate kinase [Thermosphaera aggregans]; AA=GCF_000092185.1; RF=na; TAX=633148; STAX=54254; NAME=Thermosphaera aggregans DSM 11486; strain=DSM 11486; AL=Complete Genome; RT=Major
Sequence
MKPRVKILATLGPSSGDFETVKKMIREGASGFRINYAHGDSKAWDLYVKMVRDASAELGV
TVSIIGDLPGPQVRSGDFEEFSVKRGDQVRLEHASAGSGSKTIPIAVRELFAILEPGDVV
LYGDGEVSLRVLSIDEHSSTLLALNDGVVKPRKKIVVQGKEINLPMLSGRDMELLNHAVS
NQLTYVALSYVRSPRDIELVKNLLRNKSFKPGIIAKIETRPAYLNLREIAELADAVLVAR
GDLGLHFPLEEVPLIQKNIVAVANSLGKPSIVATQVMESMIDNPRPSRSDVVDVYNSVYD
MVDAVMLTNETAVGKYPVETVKWARRVIETAESRQDPVIAQRSRRMGGGLREKYAYGLLS
LAESLNAKILVYTKGNTVPPLISKHRPLVPVYVGSSSKTIAEALTIYYGLTPIVLGDSGG
DMDYEKGVEELYRVARERRLVDIGDVVVKAYVKSGTGVHEIIIEEVK
Download sequence
Identical sequences D5U303
WP_013130096.1.1770 gi|296242968|ref|YP_003650455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]