SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013130105.1.1770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013130105.1.1770
Domain Number 1 Region: 160-275
Classification Level Classification E-value
Superfamily DNA primase core 0.000000000011
Family DNA primase DnaG catalytic core 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013130105.1.1770
Sequence length 416
Comment DNA primase [Thermosphaera aggregans]; AA=GCF_000092185.1; RF=na; TAX=633148; STAX=54254; NAME=Thermosphaera aggregans DSM 11486; strain=DSM 11486; AL=Complete Genome; RT=Major
Sequence
MSKYLIRAKIEIDGVVEKHDIVGAIFGQTEGLLGDQFDLRQLQDKGRIGRIQVNTKIQGS
KTIGEILIPSNLDRVETALLAALIESVDKVGPYDASLKVVDIVDLRLEKIKKIMERAEEI
LRKWSKEKAPDVREIIKNIQEMLKAPEPISYGPDELPAGPDVEKADTIILVEGRADVINL
LRYGINNVVAIGGARKVPETVKKLAETKKIMLFVDGDHGGDLILKEVLRNLKVDFVARAP
AGREVEELTGREIEEALSKATSVFDYLNNLVKQGSKEAQHLLQIQQKLHKLPVEAKPAEV
KEEAPQPPPQPVEKEETLVIPGKLAEDAKALIGTLEAILYDQNWNTLKKIPVRDLVNELA
SVQPGSVHGILLDGILTQRLINTAAEKNVKILVGARLGKVEEKPRDIVLLTFNELS
Download sequence
Identical sequences D5U312
gi|296242977|ref|YP_003650464.1| WP_013130105.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]