SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013130184.1.1770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013130184.1.1770
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily Prefoldin 5.1e-20
Family Prefoldin 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013130184.1.1770
Sequence length 123
Comment prefoldin subunit beta [Thermosphaera aggregans]; AA=GCF_000092185.1; RF=na; TAX=633148; STAX=54254; NAME=Thermosphaera aggregans DSM 11486; strain=DSM 11486; AL=Complete Genome; RT=Major
Sequence
MSRKTLPPEVQQLIVQYQTLKETHAKIDAELKLTEAELTDVDTVLNTVKNLEDTAELYKV
VGHILVKKGKNDVIKELEERKEVLSLKRDKYKKQLDFLVKQISELEAKLKEALGRYGITV
GQA
Download sequence
Identical sequences D5U391
WP_013130184.1.1770 gi|296243056|ref|YP_003650543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]