SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013132569.1.18579 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013132569.1.18579
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Cgl1923-like 6.02e-80
Family Cgl1923-like 0.00000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013132569.1.18579
Sequence length 301
Comment PAC2 family protein [Thermobispora bispora]; AA=GCF_000092645.1; RF=representative genome; TAX=469371; STAX=2006; NAME=Thermobispora bispora DSM 43833; strain=DSM 43833; AL=Complete Genome; RT=Major
Sequence
MFDPTDLYRLDRDIPELTDPVLLYHFDGFVDAGGAGRLALGHLLATLEHRVIATFDVDRL
IDYRSRRPLMIFDTDRWVDYDTPELAIHLTQDLTGTPFLIMTGPEPDREWELFTEALGMI
VTQLKVAKLVTVHGIPMGVPHTRPLGYTAHQSRPGLVAAQPSPFGKVRVPAGLAALIEFR
LGAKGHDTFGFAIHVPHYLAQAEYPAAAVTALEAITRNTGLVFPMDGLREAAAKTTAEIE
EQISASVELSTAIRGLEQQFDAFHAGAARQDQQPENIHVPTGDELAAQFEAFLAEQEDRD
R
Download sequence
Identical sequences D6Y3T4
gi|296270297|ref|YP_003652929.1| WP_013132569.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]