SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013142425.1.49614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013142425.1.49614
Domain Number 1 Region: 24-208,256-367
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.01e-49
Family tRNA pseudouridine synthase TruD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013142425.1.49614
Sequence length 375
Comment tRNA pseudouridine(13) synthase TruD [Staphylothermus hellenicus]; AA=GCF_000092465.1; RF=na; TAX=591019; STAX=84599; NAME=Staphylothermus hellenicus DSM 12710; strain=DSM 12710; AL=Complete Genome; RT=Major
Sequence
MTLETPPCKEFIYVHPLDYVSATKYYLTCAKLDTKYYPSTETFIVEEIIDWKKLGFSKEN
GDYAVFEIRKRNIDTLKAIRIIAKDLGIPEQNILFLGFKDRDSRSKQFFFIRKNIIYDHL
VYEKVMHRDLEYEFIGYVRRKPRRKDLIGNKFVLIVKDVDKKDRDTTDHIMNMIVRHGLP
SYYGYQRFGLKRFNSHLLGKYLLTGRIDLFIREFLEGIYPSESDESIYNRSFLRFEKLLY
EKILVNAVDVFKAVNKINRMIRNILVDAYAAFLYNLLLNKIVEEKGWIGLDKVLPLPGCF
EGADFYGDILRVEGFDHSVMKHLGCWYRKGLFRPINTGLVLVGDVLKISFLLESGMYASI
IMRELFKDNLLFTRT
Download sequence
Identical sequences D7DAN0
WP_013142425.1.49614 gi|297526102|ref|YP_003668126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]