SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013142855.1.49614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013142855.1.49614
Domain Number 1 Region: 14-77
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000314
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 
Weak hits

Sequence:  WP_013142855.1.49614
Domain Number - Region: 76-119
Classification Level Classification E-value
Superfamily Prefoldin 0.000628
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013142855.1.49614
Sequence length 127
Comment hypothetical protein [Staphylothermus hellenicus]; AA=GCF_000092465.1; RF=na; TAX=591019; STAX=84599; NAME=Staphylothermus hellenicus DSM 12710; strain=DSM 12710; AL=Complete Genome; RT=Major
Sequence
MSYWWYRIMKRYRPPPPPPWYAPPYPYQYPYQQQTQPQQQTQQVQQPTQQQWRPPQPPQP
VYQPVPPYFPPPPLPMSPEEELAMLEDYKKALEEDLKELQEELRSVEERIKELRETLKKQ
GGEATYR
Download sequence
Identical sequences D7DBW0
gi|297526532|ref|YP_003668556.1| WP_013142855.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]