SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013152584.1.62139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013152584.1.62139
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Cgl1923-like 1.57e-81
Family Cgl1923-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013152584.1.62139
Sequence length 279
Comment MULTISPECIES: carboxylate--amine ligase [Nocardiopsis]; AA=GCF_000381685.1; RF=na; TAX=1169153; STAX=1169153; NAME=Nocardiopsis sp. CNS-639; strain=CNS639; AL=Scaffold; RT=Major
Sequence
MTKLVRELVDPVMVAAFEGWNDAGEAASLAVEHLSREWDAYELCALAPDDYYDFQVTRPR
MSIVDGVVGEVEWPTTRVRVATPPGSERDVVLVTGPEPNMRWRSYAADLLAVARELGVTR
MVMLGSLLADAPHTRPIPVTGMASPVELGSALGLEATTYSGPTGIVGVVHEAFSAVGIET
ASLWAAIPHYVAQPPCPKASLALLAWVEDFLGARVPLGDLPEDAVAWESNVNELTAEDED
IAAYVRGLEEAKDTADLPEASGDAIARDFERYLRRHDEG
Download sequence
Identical sequences A0A223QC48 D7B416
gi|297560509|ref|YP_003679483.1| WP_013152584.1.62139 WP_013152584.1.70090 WP_013152584.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]