SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013189797.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013189797.1.25658
Domain Number 1 Region: 561-981
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.67e-136
Family DNA polymerase I 0.0000000128
Further Details:      
 
Domain Number 2 Region: 364-554
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.67e-43
Family DnaQ-like 3'-5' exonuclease 0.00016
Further Details:      
 
Domain Number 3 Region: 19-169
Classification Level Classification E-value
Superfamily PIN domain-like 8.69e-43
Family 5' to 3' exonuclease catalytic domain 0.00005
Further Details:      
 
Domain Number 4 Region: 199-313
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.99e-33
Family 5' to 3' exonuclease, C-terminal subdomain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013189797.1.25658
Sequence length 982
Comment DNA polymerase I [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MPLSSFNNLTSDSTISNNPTFILVDGHSLAFRSYFAFAKGKNGGLRTKAGIPTSVCFGFI
KCLLEVITTQKPQAIAVAFDLGLPTFRHEADDTYKADRLETPEDFIPDLENLNELLRGLN
LPIFTAPGYEADDVLGTLSQKASAAGYRVKILSGDRDLFQLIDGDKGITVLNFSPEALKR
YANSITEFQAEQVKEKLGVLPTQIVDFKALCGDKSDNIPGVRGIGEKTAVKLLNTYNSLD
GIYAKLDEITGSTQEKLIAGKEDASHSRYLAQIVVDVPLEVNLEDCQLTGFDTNQLIPIL
EKLEFNKFLDQINELQQKLGGQVLETKAEEINTTQEDDDLWFFSGEDTANTEKRPDSSIQ
IRIINTEDKLQELVAILQKCTNLEKPVAWDTETTALEPRDAALVGIGCCWGTGSDEAAYI
PVGHKIGHNLQLDLVVSALRPILENANYPKTFQNAKFDRLIFKCQGINLVGVVFDTMLAS
YLINPDTTHNLSDLSLRNLGLQLTEYNDIVTKTGKKELQKNIADIGIDIVAYYCGTQVYA
TFQLVDKLRCELNKTPDLAKLLVEVEQPLEAVLAEMEYTGVRINSSYLQELSQQLESELA
KLEIQATEIASEKFNLDSPKQLSYILFDKLGLSTKYSRKIQTGYSTDAATLEKLQEVDNT
GFVDAIIEYRTSSKLKSTYVDALPALVHPQSQRLHTDFNQTATSTGRLSSSNPNLQNIPI
RTAFSRQIRKAFLPESGWLMVAADYSQIELRILAHLSQEPVLVQAYKQNEDIHTVTAKLV
FEKDEVTSEERRFAKTINFGVIYGMGSLKFARSTGVDKANANEFIRRFNERYPQVFAYLE
KVKKEAISQGYVETILGRRRYFDFTSKSLKELKGISLEDIDLSRLKNLGAYNAGLLRSAA
NAPIQGSSADIIKIAMVQLHEVLRNYQARLLLQVHDELVFEVPPQEWGELQLQIKSVMEN
AMSLSVPLVVDVRAGDNWMETK
Download sequence
Identical sequences D7DVE6
WP_013189797.1.25658 gi|298489723|ref|YP_003719900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]