SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013190377.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013190377.1.25658
Domain Number 1 Region: 109-311
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-58
Family BC ATP-binding domain-like 0.00000299
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.87e-27
Family BC N-terminal domain-like 0.0000895
Further Details:      
 
Domain Number 3 Region: 318-387
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 7.22e-18
Family BC C-terminal domain-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013190377.1.25658
Sequence length 389
Comment phosphoribosylglycinamide formyltransferase 2 [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MKTSLQLPQKLMLLGSGELGKEFVIAAQRLGNYVIAIDRYANAPAMQVADCSEVISMLSA
DDLETVVTKHQPDFIIPEIEAIRTEKLQEFEQRGIIVIPTATATNYTMNRDIIRELAHQE
LGVRTAEYRYAFTLEELITVSDEIGFPNVVKPVMSSSGKGQSVVQDRTEVEKAWSYAISN
SRGDSQKIIVEEFINFEIEITLLTIKQWDAPTIFCPPIGHSQERGDYQESWQPANISEDK
ILASQEIAKKVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTGMVTLISQNLNEFELH
LRAILGLPIPHIEQLGFSASAVILASEKSDSIAFTGVADALAEKDVDIQLFGKPTAHPYR
RMGVALAKGTDVEDAREKATTAASKVKLI
Download sequence
Identical sequences D7E281
gi|298490305|ref|YP_003720482.1| WP_013190377.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]