SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013191530.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013191530.1.25658
Domain Number 1 Region: 1-212
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.23e-47
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 333-458
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.16e-34
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 231-325
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.89e-34
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013191530.1.25658
Sequence length 463
Comment UDP-glucose/GDP-mannose dehydrogenase family protein [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MRVCVIGTGYVGLVTGACLAYIGHDVICIDNNEEKVKLMKSGQSPIFEPGLSEIMQSAIN
SRNIQFSSDLPAGVAHGEILFIAVGTPPLPNGESDTRYVEAVARGIGANLNGGYKVIVNK
STVPIGSGDWVRMIVLDGIAERQKTLIPISGSSCEEKLPEISAQFDVVSNPEFLREGSAV
YDTFNPDRIVLGGNSLQAIGMMKDLYAPIVERKFAADQSLPPVPVLVTDLSSAEMIKYAA
NAFLATKISFINEVANICDRVGADVTQVAKGIGLDSRIGNKFLQAGIGWGGSCFPKDVSA
LIHTADDYGYEAQLMKAAVSVNERQRLIALEKLQQALKILKGKTVGLLGLTFKPDTDDLR
DAPALNLIEQLNRLGAKVKAYDPIISQTGMRHGLSGVLVETDAERLADSCDALVLVTEWQ
QFSTLDYGKMARLMNHAVMIDGRNFLDPEAMVRDGFQYVGVGR
Download sequence
Identical sequences D7DZN2
gi|298491460|ref|YP_003721637.1| WP_013191530.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]