SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013191728.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013191728.1.25658
Domain Number 1 Region: 166-285
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.25e-32
Family Homoserine kinase 0.0025
Further Details:      
 
Domain Number 2 Region: 7-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-31
Family GHMP Kinase, N-terminal domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013191728.1.25658
Sequence length 303
Comment homoserine kinase [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MSVISTITVKVPATTANLGPGFDCIGAALKLYNEFKFTRNERGLIIQVSGTEAEKVQTDE
SNLLYQAFLKLYQYIEQTSPSVKIEIKLGVPLARGLGSSATAIVGGLVAGNVLAGSPLSE
LQVMELAIAMEGHPDNVVPALLGGCCLAATGLTGWEICDITWHRQIVPVIAIPDFELSTL
EARQVLPTEVSRGDAIFNTAHFGLLLRGLATHREEWLRAALQDKLHQPYRQALIPGYDAV
EAAAVAAGAYGMVISGAGPTLLALTDELHTPGVATAMRNAWKQVGIKSVAQSLPLDIQGV
TIF
Download sequence
Identical sequences D7E0Q6
WP_013191728.1.25658 gi|298491658|ref|YP_003721835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]