SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013192085.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013192085.1.25658
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.09e-35
Family N-terminal domain of MutM-like DNA repair proteins 0.00041
Further Details:      
 
Domain Number 2 Region: 138-227
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.64e-28
Family Middle domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 227-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013192085.1.25658
Sequence length 278
Comment DNA-formamidopyrimidine glycosylase [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MPELPEVETVRRGLNQLTLNEGITGGDILLKRTVAYPFYVSEFIDNLKGSSIKSWHRRGK
YLLAELTPSSTCLGVHLRMTGQLLWLNQNEPLHKHTRVRLFFGEKQELRFVDQRTFGQMW
YVPPGVPVESIIRGLAQLAVDPFSPEFTVEYLANKLQKGRRPIKTALLDQSIVAGLGNIY
ADEALFKSGILPTTLCTDLQKKQVEPLRTAIIKVLSASIAAGGTTFSNFLNVKGINGNYG
GEAWVYKRTGKPCKVCGNVIQRIKLGGRSSHFCSQCQK
Download sequence
Identical sequences D7E303
gi|298492017|ref|YP_003722194.1| WP_013192085.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]