SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013192332.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013192332.1.25658
Domain Number 1 Region: 222-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.17e-70
Family Leukotriene A4 hydrolase catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 21-214
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.92e-46
Family Leukotriene A4 hydrolase N-terminal domain 0.00075
Further Details:      
 
Domain Number 3 Region: 545-832
Classification Level Classification E-value
Superfamily ARM repeat 2.61e-23
Family PBS lyase HEAT-like repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013192332.1.25658
Sequence length 858
Comment aminopeptidase [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MSHLYFDTENNGHKSFELPGAKPHYNPDRPGQVEHIFLDLTLNIPNQSYYGNCSIRLLPI
RNNIDCLTLDAVNLNIQSVQVDEAEQKFEYDGEKLAILLSEPTQIGQRLLIAIAYSVEKP
QRGIYFIQPDKHYPHKPTQVWTQGEDEDSRFWFPCFDYPGQLSTSEICVRVAKPLIAISN
GELIDTFEDGNQQIYHWSQQQVHPTYLMTLAVGDFAEIRDAWQGKPVTYYVDKGREADAK
RSMGKTPRMIEFLSEKYGYPYPFPKYAQVCVDDFIFGGMENTSTTLLTDRCLLDERASLD
NFNTESLVVHELAHQWFGDLIVIKHWSHAWIKEGMASYSEVMWTEHEYGKDDAAYYQLLQ
ARSYLNEDSSRYRRPMVTHVYREAIELYDRHIYEKGSCVYNMIRTELGDELFWTAIQTFV
QDHAHQTVETVDLLRAIEKATGLNLTFLFDQYVYRGGHPDFKVAYSWDGDSKLAKVTVTQ
TQVNSNNKDLFDLKIPIGFAYSQQTLNLTSFTVRVNEKEQSFYFPLAEKPDFISFDVGNN
YLKTVTLEYPIPELKAQLEFDPDPISRIYAAEALAKKGGLEVTKVLSTALKNDPFWGVRV
EVAQKLSEIQLYQAFDGLVIGLQDPSPFVRKAVVSSLSQIKTHPSYKAVKAVVQNGDPSY
NVEAAACRTIGAIAAAHLEEKPHEEKVIKLLKSVLEERAGWNEVIRSGAISGLAEFKTSE
TALNLLLEYTKIGVSQPLRLSTTRALGKISVGQTPTNVERILDRLAEIAKEAFFLTQVAV
VTALGQMETPKAIGILQSLASQTTDGRVRRYAEEEIIKVQKNIGPEKTLRQLREELNQLK
QQNQELKSRLENLEAKSK
Download sequence
Identical sequences D7E4A1
gi|298492265|ref|YP_003722442.1| WP_013192332.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]