SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013192710.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013192710.1.25658
Domain Number 1 Region: 19-213,314-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4e-88
Family Bacterial dinuclear zinc exopeptidases 0.0000171
Further Details:      
 
Domain Number 2 Region: 197-315
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.53e-31
Family Bacterial exopeptidase dimerisation domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013192710.1.25658
Sequence length 405
Comment peptidase M20 [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MVSTFPSSSTENLSNVRLQIRSLQPQLIEWRRGIHQKPELGFQEKLTAEFISQKLQAWGV
EHQTGIAETGIVVIIKGEKSQYGKVLGIRADMDALPVQEENEVSYCSQHDGVMHACGHDG
HTAIAMGTAYYLQQHRQDFAGTVKIIFQPAEEGPGGAKPMIEAGVLKNPDVDAMIGLHLW
NDLPVGTVGVRPGPLLAAVDFFNCTILGKGGHGALPHQTIDSIVVAAQIVNALQTIVARN
VNPLDSAVVTIGELHAGTKMNVIAHTARMTGSLRYFNTDLAGFFKQRIEQIIAGVCQSHG
ANYDLEYINLYPAVINNPGIAELVRNVAESVVETPVNIVPECQIMGSEDMSFFLQEVPGC
YFLLGSANAAKNLNYPHHHPRFDFDETALVMGVEMFVRCVEKYFS
Download sequence
Identical sequences D7DWN6
gi|298492645|ref|YP_003722822.1| WP_013192710.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]