SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013193297.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013193297.1.25658
Domain Number - Region: 172-209
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00184
Family Rho termination factor, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013193297.1.25658
Sequence length 218
Comment hypothetical protein [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MSAIITNYRQLDVAFLLLNNLRIKLRTAGVRISVRKVGNVHRITVSKQPTVATIEQIVGA
TNAKTETRNLSSNNAISSPTEITSSTDDTRSENGANIAPTVNKEIEDNSVVKVITETLSE
STSPLDESHTGYSKDIICDNTAEIITNSTNFPTPAYSSLEITNISDSPELANLENLQTLT
LKRLRKLAKLHKVPGFSRMKEEKLVTKLHGLAIKELVL
Download sequence
Identical sequences D7E5M9
WP_013193297.1.25658 gi|298501414|ref|YP_003723411.1|NC_014249 gi|298501414|ref|YP_003723411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]