SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013193714.1.99978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013193714.1.99978
Domain Number 1 Region: 8-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000326
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013193714.1.99978
Sequence length 38
Comment hypothetical protein [Methanohalobium evestigatum]; AA=GCF_000196655.1; RF=representative genome; TAX=644295; STAX=2322; NAME=Methanohalobium evestigatum Z-7303; strain=Z-7303; AL=Complete Genome; RT=Major
Sequence
MGDKSEKKENKFECKVCEMTFPTRQDYERHMKKHHESG
Download sequence
Identical sequences D7E6C4
gi|298674192|ref|YP_003725942.1| WP_013193714.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]