SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013224718.1.53613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013224718.1.53613
Domain Number 1 Region: 1-395
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 8.64e-77
Family Gtf glycosyltransferase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013224718.1.53613
Sequence length 397
Comment glycosyl transferase [Amycolatopsis mediterranei]; AA=GCF_000220945.1; RF=na; TAX=713604; STAX=33910; NAME=Amycolatopsis mediterranei S699; strain=S699; AL=Complete Genome; RT=Major
Sequence
MTRVLVCVQPARGHVGPTKPIVGALVAAGHDVAVVTGARYRQAFEDLGAAVRLLPGQADF
DETDLDGSIPGRAGRRGLDLARFELTHFVRAMPAQLSVIDAQEADVVLCDPLMMAGLALV
RRERRPRLLTLGFLPFMPPVPTGPPGHPLRAALLKTLVPWVTGPARKLTKDLLGGDPGLL
FTDWPLLSDGVLQMTCPGFEYPRTGVPLHFIGPTTVSAASEHPLPPWWADLDGGRPVVHV
TQGTVANDDLGRLVEPTIEALAGEDVLVVATTCGELLRPGPLPENVRVADFLPYDELLPR
CAAMVGNGGYGGVNHALRYGVPLVVVGASEDKREVAARVTWSGAGIGRARASATPRTLRR
AVRTVLDDPRYRDRARELAAEMAAGPTMDEVVQLITG
Download sequence
Identical sequences A0A0H3D1W9 G0FI08
gi|532459502|ref|YP_008459155.1| gi|300784756|ref|YP_003765047.1| WP_013224718.1.26188 WP_013224718.1.53613 WP_013224718.1.63706 WP_013224718.1.79787 WP_013224718.1.88400 WP_013224718.1.99940 YP_003765047.1.66228 gi|399536640|ref|YP_006549303.1| gi|399536640|ref|YP_006549303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]