SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013225998.1.99940 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013225998.1.99940
Domain Number - Region: 130-183
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00425
Family PriA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013225998.1.99940
Sequence length 334
Comment ATP-dependent DNA ligase [Amycolatopsis mediterranei]; AA=GCF_000700945.1; RF=na; TAX=33910; STAX=33910; NAME=Amycolatopsis mediterranei; strain=DSM 46096; AL=Contig; RT=Major
Sequence
MSGAVLLDVDGVEVKISSPDKVYFPERGETKLDLVEYYRAISGPLLARLGGRPLLLERYP
DGAGGKNWFQKRVPKGTPPWLTTTVVSTPNGTTSDALVAKDLAHLLWAVNLGCLGFHVWP
YLADTPEVTDELRVDLDPSPGIGFDELREAAVLTREFLAEHGIEGHLKTSGSRGLHLYVL
LEPRWDSFQVRAAAVALARALERRHPEKITAQWWKEERGSRVFVDFNQNAPHKTVFGTWC
VRPRVGGQVSTPIGWDELDTVEPDTLTLSTVPARVAERGDPWAGAGERPQSIEPLLAMSE
RDMADGLMDAPWPPVYPKMPNEPPRVAPSRAKKA
Download sequence
Identical sequences A0A0H3D5N1 G0FQ74
gi|300786037|ref|YP_003766328.1| gi|399537920|ref|YP_006550582.1| WP_013225998.1.26188 WP_013225998.1.53613 WP_013225998.1.63706 WP_013225998.1.79787 WP_013225998.1.88400 WP_013225998.1.99940 YP_003766328.1.66228 gi|399537920|ref|YP_006550582.1| gi|532460781|ref|YP_008460433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]