SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013228372.1.26188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013228372.1.26188
Domain Number 1 Region: 3-364
Classification Level Classification E-value
Superfamily Serpins 1.96e-87
Family Serpins 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013228372.1.26188
Sequence length 364
Comment serine protease [Amycolatopsis mediterranei]; AA=GCF_001742805.1; RF=na; TAX=33910; STAX=33910; NAME=Amycolatopsis mediterranei; strain=HP-130; AL=Scaffold; RT=Major
Sequence
MATDSHLRFALAVHSALGAGGGNTCFSPYSVASALTLAARAARGQTRDELVALLGDPGEQ
TVLLREAARLVEEAHSKDQPELAVANTLWADDRLPLEDSFKAELAEWPGAAVASAPFEKE
PEAARALINEDIGRTTRGLIPQLLPLGSIDSQVAAVLVNALYLKAAWKLPFREANTSDAP
FHAPSGTRDVPTMWLSESVGYAHTGGWQAVRLVAAGGLQAVVLLPDDDLAEAETRLDHAA
LTSLLGKIRAKKVELSLPKVSLDVSSKLAGVLRGLGVRTMFTDEADLSGLTPDPRLTVSE
VLHQAVLRVDEQGFEGAAATALIMRLTSMMIDDPVAVTVDRPFLLLVRHAGTGALYFIAR
VVEP
Download sequence
Identical sequences A0A0H3DE38 G0FU17
gi|300788434|ref|YP_003768725.1| gi|399540317|ref|YP_006552979.1| gi|532463178|ref|YP_008462830.1| WP_013228372.1.26188 WP_013228372.1.53613 WP_013228372.1.63706 WP_013228372.1.79787 WP_013228372.1.88400 WP_013228372.1.99940 YP_003768725.1.66228 gi|399540317|ref|YP_006552979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]